This product is an unconjugated anti-Human Complement Factor H Polyclonal antibody generated from the Rabbit. The antibody can be used for WB; IHC.
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Clonality | Polyclonal |
Host Animal | Rabbit |
Isotype | IgG |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKA |
Species Reactivity | Human |
Applications | WB; IHC |
Application Notes | WB: 0.04-0.4 µg/mL IHC: 1:200 - 1:500 The optimal working dilutions should be determined by the end user. |
Specificity | This antibody reacts with Human complement Factor H. |
Purity | ≥95% as determined by SDS-PAGE |
Format | Liquid |
Size | 25; 100 µL |
Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Type | Primary Antibody |
Target Name | Factor H |
Alternative Names | Age-Related Maculopathy Susceptibility 1; H Factor 1 (Complement); H Factor 2 (Complement); Adrenomedullin Binding Protein; Beta-1-H-Globulin; Factor H-Like 1; H Factor 1; Factor H; Beta-1H; FH; HF; HF1; HF2; HUS; FHL1; AHUS1; AMBP1; ARMD4; ARMS1; CFHL3 |
Gene ID | 3075 |
UniProt ID | P08603 |
Introduction | Complement Factor H is a protein with twenty short consensus repeat domains encoded by human CFH gene. It is a member of the regulators of complement activation family and is a complement control protein. It is a large (155 kilodaltons), soluble glycoprotein that circulates in human plasma (at typical concentrations of 200-300 micrograms per milliliter). Factor H is secreted into the bloodstream and has an essential role in the regulation of complement activation, restricting this innate defense mechanism to microbial infections. |